Antibodies

Jump to Filters
View as table Download
STEAP1 Rabbit Polyclonal Antibody
TA306462

USD 430.00

2 Weeks

Rabbit Polyclonal STEAP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STEAP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human STEAP1.
STEAP1 Rabbit Polyclonal Antibody
TA306463

USD 430.00

5 Days

Rabbit Polyclonal STEAP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STEAP1 antibody was raised against a 16 amino acid peptide from near the center of human STEAP1.
STEAP1 Rabbit Polyclonal Antibody
AP22946PU-N

USD 440.00

2 Weeks

STEAP1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Spred1 antibody was raised against a 14 amino acid peptide near the center of the human Spred1.
STEAP1 Rabbit Polyclonal Antibody
TA341709

USD 375.00

5 Days

Rabbit Polyclonal Anti-STEAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STEAP1 antibody: synthetic peptide directed towards the N terminal of human STEAP1. Synthetic peptide located within the following region: FYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLD