YIF1B (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 81-110 amino acids from the N-terminal region of human YIF1B |
YIF1B (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 81-110 amino acids from the N-terminal region of human YIF1B |
Rabbit Polyclonal Anti-YIF1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-YIF1B Antibody: synthetic peptide directed towards the middle region of human YIF1B. Synthetic peptide located within the following region: LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA |