YIF1B Rabbit Polyclonal Antibody

CAT#: TA335416

Rabbit Polyclonal Anti-YIF1B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "YIF1B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-YIF1B Antibody: synthetic peptide directed towards the middle region of human YIF1B. Synthetic peptide located within the following region: LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name Yip1 interacting factor homolog B, membrane trafficking protein
Background YIF1B belongs to the YIF1 family. It is a multi-pass membrane protein. The functions of YIF1B remain unknown.
Synonyms FinGER8
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.