Antibodies

Jump to Filters
View as table Download
YIF1B (N-term) Rabbit Polyclonal Antibody
AP54596PU-N

USD 450.00

2 Weeks

YIF1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 81-110 amino acids from the N-terminal region of human YIF1B
YIF1B Rabbit Polyclonal Antibody
TA335416

USD 375.00

5 Days

Rabbit Polyclonal Anti-YIF1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-YIF1B Antibody: synthetic peptide directed towards the middle region of human YIF1B. Synthetic peptide located within the following region: LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA
YIF1B Rabbit Polyclonal Antibody
TA361745

USD 360.00

5 Days

YIF1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human YIF1B