Rabbit polyclonal anti-ARG2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARG2. |
Rabbit polyclonal anti-ARG2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARG2. |
Rabbit Polyclonal Anti-ARG2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the N terminal of human ARG2. Synthetic peptide located within the following region: LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH |
Rabbit Polyclonal Anti-ARG2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the C terminal of human ARG2. Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT |
Arginase 2 (ARG2) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-354 of human Arginase 2 (Arginase 2 (ARG2)) (NP_001163.1). |
Modifications | Unmodified |