Antibodies

Jump to Filters
View as table Download
ANGPTL3 Rabbit Polyclonal Antibody
TA349022

USD 484.00

5 Days

Rabbit Polyclonal Anti-LAMTOR2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LAMTOR2 antibody was raised against an 18 amino acid peptide near the center of human LAMTOR2.
ANGPTL3 Rabbit Polyclonal Antibody
TA344097

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-ANGPTL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANGPTL3 antibody: synthetic peptide directed towards the N terminal of human ANGPTL3. Synthetic peptide located within the following region: VKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEI
ANGPTL3 Rabbit Polyclonal Antibody
TA344098

USD 475.00

5 Days

Rabbit Polyclonal Anti-ANGPTL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANGPTL3 antibody: synthetic peptide directed towards the N terminal of human ANGPTL3. Synthetic peptide located within the following region: IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL
ANGPTL3 Rabbit Polyclonal Antibody
TA372967

USD 380.00

4 Weeks

ANGPTL3 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ANGPTL3
ANGPTL3 Rabbit Polyclonal Antibody
TA326849

USD 345.00

3 Weeks

Rabbit anti-ANGPTL3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANGPTL3
ANGPTL3 Rabbit Polyclonal Antibody
TA321837

USD 345.00

4 Weeks

Anti-ANGPTL3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of Human Angiopoietin-related protein 3