Antibodies

View as table Download

Rabbit Polyclonal Anti-Cib1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cib1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Cib1. Synthetic peptide located within the following region: GGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHT

Rabbit Polyclonal Anti-CIB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CIB1

CIB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CIB1

CIB1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human CIB1 (NP_006375.2).
Modifications Unmodified