Rabbit Polyclonal Anti-CNPY3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNPY3 antibody: synthetic peptide directed towards the N terminal of human CNPY3. Synthetic peptide located within the following region: MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCE |
Rabbit Polyclonal Anti-CNPY3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNPY3 antibody: synthetic peptide directed towards the middle region of human CNPY3. Synthetic peptide located within the following region: KGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGI |
Rabbit Polyclonal Anti-CNPY3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TNRC5 Antibody: synthetic peptide directed towards the C terminal of human TNRC5. Synthetic peptide located within the following region: GGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLT |
CNPY3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CNPY3 |
CNPY3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 31-278 of human CNPY3 (NP_006577.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
