TNRC5 (CNPY3) Rabbit Polyclonal Antibody

CAT#: TA344530

Rabbit Polyclonal Anti-CNPY3 Antibody - N-terminal region

Product Images

WB Suggested Anti-CNPY3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: ACHN cell lysateCNPY3 is supported by BioGPS gene expression data to be expressed in ACHN

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNPY3 antibody: synthetic peptide directed towards the N terminal of human CNPY3. Synthetic peptide located within the following region: MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31
• Gene Name: canopy FGF signaling regulator 3
• Database Link:
  NP_006577
  Entrez Gene 10695 Human
  UniProt ID Q9BT09
• Background: PRAT4A is associated with the immature form of TLR4 (MIM 603030) and regulates its cell surface expression (Wakabayashi et al., 2006 [PubMed 16849487]).
• Synonyms: CAG4A; ERDA5; PRAT4A; TNRC5
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 92%; Pig: 85%; Mouse: 85%; Guinea pig: 85%