Antibodies

View as table Download

Rabbit polyclonal anti-ELF4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ELF4.

Rabbit polyclonal ELF4 Antibody (Center)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ELF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 211-237 amino acids from the Central region of human ELF4.

Rabbit Polyclonal anti-ELF4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the N terminal of human ELF4. Synthetic peptide located within the following region: RKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKY

Rabbit Polyclonal Anti-ELF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the C terminal of human ELF4. Synthetic peptide located within the following region: VTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLS

Rabbit Polyclonal Anti-ELF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the N terminal of human ELF4. Synthetic peptide located within the following region: MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYS

Rabbit Polyclonal Anti-Elf4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVT