Antibodies

Jump to Filters
View as table Download
HOXB6 Rabbit Polyclonal Antibody
TA371823

USD 380.00

4 Weeks

HOXB6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXB6
HOXB6 Goat Polyclonal Antibody
TA326753

USD 375.00

5 Days

Goat Anti-HOXB6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EPRKSDCAQDKS, from the internal region of the protein sequence according to NP_061825.2.
HOXB6 Rabbit Polyclonal Antibody
TA329257

USD 375.00

5 Days

Rabbit Polyclonal anti-HOXB6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB6 antibody: synthetic peptide directed towards the N terminal of human HOXB6. Synthetic peptide located within the following region: ALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN
HOXB6 Rabbit Polyclonal Antibody
TA367595

USD 380.00

4 Weeks

HOXB6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXB6
HOXB6 Rabbit Polyclonal Antibody
TA377191

USD 220.00

3 Weeks

HOXB6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human HOXB6 (NP_061825.2).
Modifications Unmodified