Antibodies

View as table Download

Rabbit Polyclonal Anti-SSBP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSBP4 antibody: synthetic peptide directed towards the N terminal of human SSBP4. Synthetic peptide located within the following region: MYAKGGKGSAVPSDSQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKN

Rabbit Polyclonal Anti-SSBP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSBP4 antibody: synthetic peptide directed towards the C terminal of human SSBP4. Synthetic peptide located within the following region: DGLPKSSPGAVAGLSNAPGTPRDDGEMAAAGTFLHPFPSESYSPGMTMSV

Rabbit Polyclonal Anti-SSBP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSBP4 antibody: synthetic peptide directed towards the middle region of human SSBP4. Synthetic peptide located within the following region: PHHVNGSLGSGDMDGLPKSSPGAVAGLSNAPGTPRDDGEMAAAGTFLHPF

Rabbit Polyclonal Anti-SSBP4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SSBP4