Antibodies

View as table Download

YY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human YY1

Rabbit polyclonal anti-YY1 antibody(N-term), Loading control

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This YY1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 74-104 amino acids from the N-terminal region of human YY1.

Rabbit Polyclonal Anti-YY1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR

Rabbit Polyclonal Anti-YY1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: GADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGEN

Rabbit Polyclonal Anti-YY1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YY1 antibody: synthetic peptide directed towards the N terminal of human YY1. Synthetic peptide located within the following region: MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDD

YY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human YY1

YY1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human YY1

YY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human YY1

YY1 Rabbit polyclonal Antibody

Applications ChIP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human YY1 (NP_003394.1).
Modifications Unmodified

YY1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human YY1