Antibodies

View as table Download

Rabbit Polyclonal ZMYND8 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMYND8 antibody: human ZMYND8 (zinc finger, MYND-type containing 8), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein.

Rabbit Polyclonal Anti-PKCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKCB1 Antibody: A synthesized peptide derived from human PKCB1

Rabbit polyclonal anti-PKCB1 (PKC Binding Protein 1) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PKCB1.

Rabbit Polyclonal Anti-ZMYND8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMYND8 antibody: synthetic peptide directed towards the N terminal of human ZMYND8. Synthetic peptide located within the following region: TAQKRKFPSPPHSSNGHSPQDTSTSPIKKKKKPGLLNSNNKEQSELRHGP

Rabbit Polyclonal Anti-ZMYND8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMYND8 antibody: synthetic peptide directed towards the middle region of human ZMYND8. Synthetic peptide located within the following region: SVSKRCDKQPAYAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTR

ZMYND8 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 959-1188 of human ZMYND8 (NP_898868.1).
Modifications Unmodified