PRKCBP1 (ZMYND8) Rabbit Polyclonal Antibody

CAT#: TA337718

Rabbit Polyclonal Anti-ZMYND8 Antibody

Product Images

WB Suggested Anti-ZMYND8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZMYND8 antibody: synthetic peptide directed towards the middle region of human ZMYND8. Synthetic peptide located within the following region: SVSKRCDKQPAYAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 131 kDa
• Gene Name: zinc finger MYND-type containing 8
• Database Link:
  NP_898868
  Entrez Gene 23613 Human
  UniProt ID Q9ULU4
• Background: The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: PRKCBP1; PRO2893; RACK7
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Bovine: 93%; Pig: 92%; Horse: 92%; Mouse: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors