Antibodies

View as table Download

Rabbit polyclonal antibody to ZNF165 (zinc finger protein 165)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 129 and 461 of ZNF165 (Uniprot ID#P49910)

Rabbit Polyclonal Anti-ZNF165 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF165 antibody: synthetic peptide directed towards the middle region of human ZNF165. Synthetic peptide located within the following region: ISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTV

Rabbit Polyclonal Anti-ZNF165 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF165 antibody: synthetic peptide directed towards the middle region of human ZNF165. Synthetic peptide located within the following region: THQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAA