Antibodies

View as table Download

ALDH4A1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH4A1

Rabbit Polyclonal ALDH4A1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Anti-ALDH4A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH4A1 antibody: synthetic peptide directed towards the C terminal of human ALDH4A1. Synthetic peptide located within the following region: RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI

Rabbit Polyclonal Anti-ALDH4A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH4A1 antibody: synthetic peptide directed towards the N terminal of human ALDH4A1. Synthetic peptide located within the following region: QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL

Rabbit Polyclonal Anti-Aldh4a1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Aldh4a1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV

Carrier-free (BSA/glycerol-free) ALDH4A1 mouse monoclonal antibody,clone OTI1H10

Applications IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-ALDH4A1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1

Anti-ALDH4A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1

ALDH4A1 mouse monoclonal antibody,clone OTI1H10

Applications IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

ALDH4A1 mouse monoclonal antibody,clone OTI1H10

Applications IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated