ALDH4A1 Rabbit Polyclonal Antibody

CAT#: TA338296

Rabbit Polyclonal Anti-ALDH4A1 Antibody

Product Images

WB Suggested Anti-ALDH4A1 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate. ALDH4A1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALDH4A1 antibody: synthetic peptide directed towards the N terminal of human ALDH4A1. Synthetic peptide located within the following region: QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: aldehyde dehydrogenase 4 family member A1
• Database Link:
  NP_001154976
  Entrez Gene 8659 Human
  UniProt ID P30038
• Background: This protein belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2009]
• Synonyms: ALDH4; P5CD; P5CDh
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Bovine: 86%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways