Antibodies

View as table Download

Rabbit anti-TFAM Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TFAM

Mouse Monoclonal mtTFA Antibody (18G102B2E11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal TFAM Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TFAM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 216-246 amino acids from the C-terminal region of human TFAM.

mtTFA (TFAM) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated

Rabbit polyclonal anti-TFAM antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TFAM.

Rabbit Polyclonal anti-TFAM antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TFAM antibody: synthetic peptide directed towards the N terminal of human TFAM. Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS