mtTFA (TFAM) Rabbit Polyclonal Antibody

CAT#: TA329264

Rabbit Polyclonal anti-TFAM antibody

Product Images

WB Suggested Anti-TFAM Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

• 

  TFAM antibody - N-terminal region validated by WB using bEND3 cell lysate at Lane 1:10 ug, Lane 2:20 ug.

• 

  TFAM antibody - N-terminal region validated by WB using bEND3 cell lysate at Lane 1:10 ug, Lane 2:20 ug.

• 

  Lanes: Lane 1 and 2: HepG2 cell lysate; Lane 3 and 4: Hep3B cell lysate; Lane 5 and 6: K562 cell lysate; Primary Antibody Dilution: 1:1000; Secondary Antibody: ; Secondary Antibody Dilution: 1:1000; Gene Name: TFAM; Submitted by: Anonymous;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFAM antibody: synthetic peptide directed towards the N terminal of human TFAM. Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: transcription factor A, mitochondrial
• Database Link:
  NP_003192
  Entrez Gene 21780 MouseEntrez Gene 7019 Human
  UniProt ID Q00059
• Background: The function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
• Synonyms: MTTF1; MTTFA; TCF6; TCF6L1; TCF6L2; TCF6L3
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Horse: 92%; Bovine: 92%; Dog: 83%; Rabbit: 83%; Mouse: 75%; Guinea pig: 75%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Huntington's disease