gamma Adaptin (AP1G1) mouse monoclonal antibody, clone IMD-113, Purified
Applications | WB |
Reactivities | Human, Rat |
gamma Adaptin (AP1G1) mouse monoclonal antibody, clone IMD-113, Purified
Applications | WB |
Reactivities | Human, Rat |
Goat polyclonal anti-AP1G1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 646-659 of Human AP1G1. |
Rabbit Polyclonal Anti-AP1G1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AP1G1 antibody: synthetic peptide directed towards the C terminal of human AP1G1. Synthetic peptide located within the following region: DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS |
Anti-AP1G1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 801-813 amino acids of Human adaptor-related protein complex 1, gamma 1 subunit |
Anti-AP1G1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 802-814 amino acids of Human Adapter-related protein complex 1 subunit gamma-1 |