RFC3 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
RFC3 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-RFC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the C terminal of human RFC3. Synthetic peptide located within the following region: IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF |
Rabbit Polyclonal Anti-RFC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the N terminal of human RFC3. Synthetic peptide located within the following region: YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL |
Carrier-free (BSA/glycerol-free) RFC3 mouse monoclonal antibody,clone OTI3F6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RFC3 mouse monoclonal antibody,clone OTI4A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RFC3 mouse monoclonal antibody,clone OTI1C7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RFC3 mouse monoclonal antibody,clone OTI2E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RFC3 mouse monoclonal antibody,clone OTI3F6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RFC3 mouse monoclonal antibody,clone OTI3F6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RFC3 mouse monoclonal antibody,clone OTI3F6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RFC3 mouse monoclonal antibody,clone OTI3F6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RFC3 mouse monoclonal antibody,clone OTI4A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RFC3 mouse monoclonal antibody,clone OTI4A7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RFC3 mouse monoclonal antibody,clone OTI4A7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RFC3 mouse monoclonal antibody,clone OTI4A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RFC3 mouse monoclonal antibody,clone OTI1C7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RFC3 mouse monoclonal antibody,clone OTI1C7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RFC3 mouse monoclonal antibody,clone OTI1C7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RFC3 mouse monoclonal antibody,clone OTI1C7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RFC3 mouse monoclonal antibody,clone OTI2E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RFC3 mouse monoclonal antibody,clone OTI2E5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RFC3 mouse monoclonal antibody,clone OTI2E5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RFC3 mouse monoclonal antibody,clone OTI2E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-RFC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC3 |
Rabbit Polyclonal anti-RFC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC3 |