DNA Ligase IV (LIG4) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 600-650 of Human DNA Ligase IV. |
DNA Ligase IV (LIG4) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 600-650 of Human DNA Ligase IV. |
Rabbit polyclonal anti-DNL4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNL4. |
Anti-LIG4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human ligase IV, DNA, ATP-dependent |
Rabbit Polyclonal Anti-LIG4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LIG4 antibody: synthetic peptide directed towards the N terminal of human LIG4. Synthetic peptide located within the following region: DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ |