Antibodies

View as table Download

Rabbit Polyclonal Anti-Myt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS

Carrier-free (BSA/glycerol-free) PKMYT1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PKMYT1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PKMYT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PKMYT1

PKMYT1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PKMYT1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PKMYT1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PKMYT1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PKMYT1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated