Antibodies

Jump to Filters
View as table Download
FGD1 Rabbit Polyclonal Antibody
TA329379

USD 375.00

5 Days

Rabbit Polyclonal anti-FGD1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGD1 antibody: synthetic peptide directed towards the C terminal of human FGD1. Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT
FGD1 Rabbit Polyclonal Antibody
TA343464

USD 375.00

5 Days

Rabbit Polyclonal Anti-FGD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGD1 antibody: synthetic peptide directed towards the N terminal of human FGD1. Synthetic peptide located within the following region: HGHRAPGGAGPSEPEHPATNPPGAAPPACADSDPGASEPGLLARRGSGSA