Rabbit Polyclonal Anti-NOX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4. |
Rabbit Polyclonal Anti-NOX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4. |
Rabbit Polyclonal antibody to PIK3R4 (phosphoinositide-3-kinase, regulatory subunit 4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 381 of PIK3R4 (Uniprot ID#Q99570) |
Rabbit Polyclonal Anti-PIK3R4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIK3R4 antibody: synthetic peptide directed towards the N terminal of human PIK3R4. Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PIK3R4 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIK3R4 |
USD 379.00
In Stock
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |