Antibodies

Jump to Filters
View as table Download
PRP18 homolog (PRPF18) Rabbit Polyclonal Antibody
TA314773

USD 345.00

In Stock

Rabbit polyclonal anti-PRPF18 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRPF18.
PRP18 homolog (PRPF18) Rabbit Polyclonal Antibody
TA343257

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRPF18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF18 antibody is: synthetic peptide directed towards the middle region of Human PRPF18. Synthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL
PRP18 homolog (PRPF18) Rabbit Polyclonal Antibody
TA358288

USD 360.00

5 Days

PRPF18 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated