PRP18 homolog (PRPF18) Rabbit Polyclonal Antibody

CAT#: TA343257

Rabbit Polyclonal Anti-PRPF18 Antibody

Product Images

Host: Rabbit; Target Name: PRPF18; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRPF18 antibody is: synthetic peptide directed towards the middle region of Human PRPF18. Synthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: pre-mRNA processing factor 18
• Database Link:
  NP_003666
  Entrez Gene 8559 Human
  UniProt ID Q99633
• Background: Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to the yeast splicing factor Prp18.
• Synonyms: hPrp18; PRP18
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Spliceosome