Antibodies

Jump to Filters
View as table Download
RBM22 Rabbit Polyclonal Antibody
TA343867

USD 475.00

5 Days

Rabbit Polyclonal Anti-RBM22 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM22 antibody: synthetic peptide directed towards the C terminal of human RBM22. Synthetic peptide located within the following region: KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF
RBM22 Rabbit Polyclonal Antibody
TA343866

USD 475.00

5 Days

Rabbit Polyclonal Anti-RBM22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM22 antibody: synthetic peptide directed towards the middle region of human RBM22. Synthetic peptide located within the following region: HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV
RBM22 (Center) Rabbit Polyclonal Antibody
AP53606PU-N

USD 450.00

2 Weeks

RBM22 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 164-193 amino acids from the Central region of Human RBM22.