RBM22 Rabbit Polyclonal Antibody

CAT#: TA343867

Rabbit Polyclonal Anti-RBM22 Antibody

Product Images

WB Suggested Anti-RBM22 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Rabbit Anti-RBM22 Antibody; Paraffin Embedded Tissue: Human Heart; Cellular Data: Myocardial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-RBM22 Antibody; Paraffin Embedded Tissue: Human Muscle; Cellular Data: Skeletal muscle cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM22 antibody: synthetic peptide directed towards the C terminal of human RBM22. Synthetic peptide located within the following region: KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: RNA binding motif protein 22
• Database Link:
  NP_060517
  Entrez Gene 55696 Human
  UniProt ID Q9NW64
• Background: RBM22 may be involved in pre-mRNA splicing.
• Synonyms: Cwc2; fSAP47; ZC3H16
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%

Reference Data

• Protein Pathways: Spliceosome