Rabbit polyclonal anti-SF3B14 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human SF3B14. |
Rabbit polyclonal anti-SF3B14 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human SF3B14. |
Rabbit Polyclonal Anti-SF3B14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the N terminal of human SF3B14. Synthetic peptide located within the following region: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV |
Rabbit Polyclonal Anti-SF3B14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the middle region of human SF3B14. Synthetic peptide located within the following region: HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK |
Carrier-free (BSA/glycerol-free) SF3B14 mouse monoclonal antibody,clone OTI8A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SF3B14 mouse monoclonal antibody,clone OTI8A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SF3B14 mouse monoclonal antibody,clone OTI8A1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
SF3B14 mouse monoclonal antibody,clone OTI8A1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SF3B14 mouse monoclonal antibody,clone OTI8A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |