Antibodies

Jump to Filters
View as table Download
PPP2R1A Rabbit Polyclonal Antibody
TA332922

USD 275.00

3 Weeks

Rabbit anti-PPP2R1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R1A
PPP2R1A Rabbit Polyclonal Antibody
TA344605

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL
PPP2R1A Rabbit Polyclonal Antibody
TA345117

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL
PPP2R1A Mouse Monoclonal Antibody [Clone ID: 4E6]
AM31921PU-N

USD 480.00

2 Weeks

PPP2R1A mouse monoclonal antibody, clone 4E6, Purified

Applications ELISA, IHC, WB
Reactivities Human
PPP2R1A Rabbit Polyclonal Antibody
AP05039PU-N

USD 360.00

5 Days

PPP2R1A rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH
PPP2R1A Sheep Polyclonal Antibody
AP05040PU-N

USD 360.00

5 Days

PPP2R1A sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH corresponding to amino acids 7-19 sequence (N-terminal) of PP2A/A regulatory subunit having a MW of 65kD
PPP2R1A Goat Polyclonal Antibody
TA311413

USD 375.00

5 Days

Goat Anti-PP2A / PPP2R1A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KYFAQEALTVLSLA, from the C Terminus of the protein sequence according to NP_055040.2.
PPP2R1A Rabbit Polyclonal Antibody
TA357329

USD 360.00

5 Days

PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R1A
PPP2R1A Rabbit Polyclonal Antibody
TA366313

USD 380.00

4 Weeks

PPP2R1A rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PPP2R1A
PPP2R1A Rabbit Polyclonal Antibody
TA370661

USD 380.00

4 Weeks

PPP2R1A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PPP2R1A
PPP2R1A Rabbit Polyclonal Antibody
TA380256

USD 220.00

3 Weeks

PPP2R1A/PPP2R2A/PPP2R1B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R1A/PPP2R2A/PPP2R1B.