Rabbit Polyclonal Anti-ADPGK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADPGK antibody: synthetic peptide directed towards the middle region of human ADPGK. Synthetic peptide located within the following region: GIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIV |
Rabbit Polyclonal Anti-ADPGK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADPGK Antibody: A synthesized peptide derived from human ADPGK |
Rabbit polyclonal anti-ADPGK antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADPGK. |
Rabbit Polyclonal Anti-ADPGK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADPGK antibody: synthetic peptide directed towards the N terminal of human ADPGK. Synthetic peptide located within the following region: WRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIH |
Rabbit Polyclonal Anti-ADPGK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADPGK antibody: synthetic peptide directed towards the N terminal of human ADPGK. Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV |
ADPGK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 217-496 of human ADPGK (NP_112574.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
