Antibodies

View as table Download

Rabbit Polyclonal Anti-AFM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AFM antibody: synthetic peptide directed towards the C terminal of human AFM. Synthetic peptide located within the following region: HADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCC

Goat Anti-Afamin / alpha Albumin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NKDDRPKDLSLRE, from the internal region of the protein sequence according to NP_001124.1.

Rabbit Polyclonal Anti-AFM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AFM antibody: synthetic peptide directed towards the middle region of human AFM. Synthetic peptide located within the following region: GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR

AFM Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-599 of human AFM (NP_001124.1).
Modifications Unmodified