AFM Rabbit Polyclonal Antibody

CAT#: TA334277

Rabbit Polyclonal Anti-AFM Antibody

Product Images

WB Suggested Anti-AFM Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AFM antibody: synthetic peptide directed towards the middle region of human AFM. Synthetic peptide located within the following region: GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: afamin
• Database Link:
  NP_001124
  Entrez Gene 173 Human
  UniProt ID P43652
• Background: AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.This gene is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. The protein encoded by this gene is regulated developmentally, expressed in the liver and secreted into the bloodstream.
• Synonyms: ALB2; ALBA; ALF
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein