Antibodies

View as table Download

Rabbit Polyclonal Anti-Phospho-ALOX5(Ser523) Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-ALOX5(Ser523) Antibody: A synthesized peptide derived from human ALOX5 around the phosphorylation site of Sersine 523
Modifications Phospho-specific

Rabbit polyclonal ALOX5 (Phospho-Ser523) antibody

Applications WB
Reactivities Human: Ser524, Rat: Ser523
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ALOX5 around the phosphorylation site of serine523.
Modifications Phospho-specific

Goat Polyclonal Antibody against Arachidonate 5-lipoxygenase

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-ERNKKKQLPYYYLSPD, from the C Terminus of the protein sequence according to NP_000689.1.

Rabbit Polyclonal 5-Lipoxygenase Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within residues 100-200 of human 5-Lipoxygenase. [Swiss-Prot# P09917]

Rabbit Anti-5-Lipoxygenase (Ser523) Antibody (Phospho-Specific)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser523 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal 5-Lipoxygenase Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Rabbit
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region within residues 600-674 of human 5-Lipoxygenase. [Swiss-Prot# P09917]

Rabbit Polyclonal Anti-ALOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human ALOX5. Synthetic peptide located within the following region: FGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYY

Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody,clone OTI1D6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody,clone OTI1A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody,clone OTI1C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody, clone OTI2C5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody, clone OTI3F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ALOX5 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 359 amino acids of Human Arachidonate 5-lipoxygenase Arachidonate 5-lipoxygenase

Anti-ALOX5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 359 amino acids of Human Arachidonate 5-lipoxygenase Arachidonate 5-lipoxygenase

ALOX5 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ALOX5 (NP_000689.1).
Modifications Unmodified

Phospho-ALOX5-S271 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S271 of human ALOX5 (NP_000689.1).
Modifications Phospho S271

ALOX5 mouse monoclonal antibody,clone OTI1D6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALOX5 mouse monoclonal antibody,clone OTI1A1, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ALOX5 mouse monoclonal antibody,clone OTI1A1, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ALOX5 mouse monoclonal antibody,clone OTI1A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALOX5 mouse monoclonal antibody,clone OTI1C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALOX5 mouse monoclonal antibody,clone OTI1C1, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ALOX5 mouse monoclonal antibody,clone OTI1C1, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ALOX5 mouse monoclonal antibody,clone OTI1C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALOX5 mouse monoclonal antibody, clone OTI2C5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALOX5 mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALOX5 mouse monoclonal antibody, clone OTI3F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALOX5 mouse monoclonal antibody, clone OTI3F1, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ALOX5 mouse monoclonal antibody, clone OTI3F1, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ALOX5 mouse monoclonal antibody, clone OTI3F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALOX5 mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALOX5 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated