Rabbit Polyclonal Anti-Claudin 4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 4 Antibody: A synthesized peptide derived from human Claudin 4 |
Rabbit Polyclonal Anti-Claudin 4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 4 Antibody: A synthesized peptide derived from human Claudin 4 |
Rabbit polyclonal anti-Claudin 4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Claudin 4. |
Rabbit Polyclonal CLAUDIN4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CLAUDIN4 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human CLAUDIN4. |
Rabbit Polyclonal Anti-CLDN4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN4 antibody is: synthetic peptide directed towards the C-terminal region of Human CLDN4. Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS |
Rabbit anti Claudin 4 Polyclonal Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-CLDN4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 193-209 amino acids of Human claudin 4 |
Anti-CLDN4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 193-209 amino acids of Human claudin 4 |
CLDN4 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CLDN4 (NP_001296.1). |
Modifications | Unmodified |
CLDN4 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CLDN4 |
Modifications | Unmodified |
Claudin 4 (4A10) Mouse monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Claudin 4 Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Claudin 4. AA range:160-209 |