Antibodies

View as table Download

Rabbit Polyclonal Anti-CLDND1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CLDND1

Rabbit Polyclonal Anti-CLDND1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLDND1 Antibody: synthetic peptide directed towards the middle region of human CLDND1. Synthetic peptide located within the following region: TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL

CLDND1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CLDND1

CLDND1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDND1