Antibodies

View as table Download

Rabbit Polyclonal Anti-CNDP2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNDP2 antibody: synthetic peptide directed towards the middle region of human CNDP2. Synthetic peptide located within the following region: LAGRRAMKTVFGVEPDLTREGGSIPVTLTFQEATGKNVMLLPVGSADDGA

Rabbit Polyclonal Anti-CNDP2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNDP2 antibody: synthetic peptide directed towards the middle region of human CNDP2. Synthetic peptide located within the following region: ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC

Carrier-free (BSA/glycerol-free) CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNDP2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CNDP2

CNDP2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CNDP2

CNDP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CNDP2

CNDP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CNDP2

CNDP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human CNDP2 (NP_060705.2).
Modifications Unmodified

CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".