Goat Polyclonal Antibody against DYX1C1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KIRNVIQGTELKS, from the C Terminus of the protein sequence according to NP_570722.2. |
Goat Polyclonal Antibody against DYX1C1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KIRNVIQGTELKS, from the C Terminus of the protein sequence according to NP_570722.2. |
Goat Anti-DYX1C1 / EKN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PLQVSDYSWQQTKT-C, from the N Terminus of the protein sequence according to NP_570722.2; NP_001028731.1; NP_001028732.1. |
Rabbit Polyclonal Anti-DYX1C1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DYX1C1 antibody: synthetic peptide directed towards the C terminal of human DYX1C1. Synthetic peptide located within the following region: FATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKA |
Rabbit Polyclonal Anti-DYX1C1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DYX1C1 antibody: synthetic peptide directed towards the middle region of human DYX1C1. Synthetic peptide located within the following region: TDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEK |