Rabbit Polyclonal antibody to DNase I (deoxyribonuclease I)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 282 of DNase I (Uniprot ID#P24855) |
Rabbit Polyclonal antibody to DNase I (deoxyribonuclease I)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 282 of DNase I (Uniprot ID#P24855) |
Rabbit Polyclonal Anti-DNASE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNASE1 antibody: synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD |
Rabbit Polyclonal Anti-DNASE1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DNASE1 |
DNASE1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DNASE1 |
DNASE1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-282 of human DNASE1 (NP_005214.2). |
Modifications | Unmodified |