Antibodies

View as table Download

Rabbit polyclonal anti-5-HT-1F antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-1F.

Rabbit Polyclonal Anti-HTR1F Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Bovine, Rabbit (100%); Mouse, Elephant, Panda, Bat, Guinea pig (95%); Platypus (84%).

5 HT1F (HTR1F) rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-HTR1F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR1F antibody: synthetic peptide directed towards the N terminal of human HTR1F. Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV

Rabbit Polyclonal Anti-HTR1F Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Guinea pig, Turkey, Chicken, Platypus (100%); Xenopus, Stickleback, Pufferfish (94%); Opossum, Lizard (88%); Horse (82%).

Rabbit Polyclonal Anti-HTR1F Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey, Panda, Bat (100%); Gibbon, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Rabbit (95%); Horse (89%).

Rabbit Polyclonal Anti-HTR1F Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Horse, Rabbit, Guinea pig, Platypus (94%); Dog, Bat (88%); Rat, Panda (81%).

HTR1F Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human HTR1F (NP_000857.1).
Modifications Unmodified