Antibodies

View as table Download

IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700022

Rabbit Polyclonal Anti-Interleukin 4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

Rabbit polyclonal anti-IL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IL4.

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human IL-4

Mouse Anti-Human IL-4 Purified (50 ug)

Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Biotin Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Biotinylated Anti-Human IL-4 Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

Rabbit Polyclonal Anti-IL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC

Rabbit Polyclonal Anti-IL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS

Mouse Monoclonal Anti-IL-4 Antibody

Reactivities Human
Conjugation Unconjugated

Mouse anti IL-4 Monoclonal Antibody

Reactivities Human
Conjugation Unconjugated

IL4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-153 of human IL4 (NP_000580.1).
Modifications Unmodified

IL-4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human IL4