Rabbit Polyclonal Anti-SYNJ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR |
Rabbit Polyclonal Anti-SYNJ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP |
SYNJ1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SYNJ1 (NP_003886.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
