Synaptojanin (SYNJ1) Rabbit Polyclonal Antibody

CAT#: TA345862

Rabbit Polyclonal Anti-SYNJ1 Antibody

Product Images

SYNJ1 antibody - N-terminal region validated by WB using human LCL at 1: 1000.

• 

  WB Suggested Anti-SYNJ1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 143 kDa
• Gene Name: synaptojanin 1
• Database Link:
  NP_982271
  Entrez Gene 8867 Human
  UniProt ID O43426
• Background: Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.Synaptojanin-1 is a phosphatidylinositol (4,5)-bisphosphate (PI(4,5)P2) that has a role in clathrin-coated pit dynamics Perera et al. (2006) [PubMed 17158794]. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3383 AB020717.2 1-3383 3384-3539 AF009040.1 3318-3473 3540-4183 AF009039.1 3522-4165 4184-7039 AB020717.2 4142-6997
• Synonyms: INPP5G; PARK20
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system