Rabbit polyclonal Anti-TMTC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMTC1 antibody: synthetic peptide directed towards the middle region of human TMTC1. Synthetic peptide located within the following region: GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV |
Rabbit polyclonal Anti-TMTC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMTC1 antibody: synthetic peptide directed towards the middle region of human TMTC1. Synthetic peptide located within the following region: LFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV |
Germany
Japan
United Kingdom
China