TMTC1 Rabbit Polyclonal Antibody

CAT#: TA331004

Rabbit polyclonal Anti-TMTC1 Antibody

Product Images

WB Suggested Anti-TMTC1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMTC1 antibody: synthetic peptide directed towards the middle region of human TMTC1. Synthetic peptide located within the following region: GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: transmembrane and tetratricopeptide repeat containing 1
• Database Link:
  NP_787057
  Entrez Gene 83857 Human
  UniProt ID Q8IUR5
• Background: TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown.
• Synonyms: ARG99; OLF; TMTC1A
• Note: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 91%

Reference Data

• Protein Families: Transmembrane