USP16 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human USP16 |
USP16 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human USP16 |
Rabbit anti-USP16 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human USP16 |
Rabbit Polyclonal Anti-USP16 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP16 antibody: synthetic peptide directed towards the N terminal of human USP16. Synthetic peptide located within the following region: CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS |
Carrier-free (BSA/glycerol-free) USP16 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) USP16 mouse monoclonal antibody,clone OTI1H8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USP16 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human USP16 |
USP16 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USP16 mouse monoclonal antibody,clone 1B4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USP16 mouse monoclonal antibody,clone 1B4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USP16 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USP16 mouse monoclonal antibody,clone OTI1H8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
USP16 mouse monoclonal antibody,clone OTI1H8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USP16 mouse monoclonal antibody,clone OTI1H8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USP16 mouse monoclonal antibody,clone OTI1H8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |