VDAC3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-283 of human VDAC3 (NP_005653.3). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
