Rabbit anti-ABT1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABT1 |
Rabbit anti-ABT1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABT1 |
Rabbit Polyclonal Anti-Abt1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the middle region of mouse Abt1. Synthetic peptide located within the following region: RQRLRAEVAQAKRETDFYLRNVEQGQHFLAADGDATRPNSSWTFTQRPTE |
Rabbit Polyclonal Anti-Abt1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the c terminal of mouse Abt1. Synthetic peptide located within the following region: QEFRARKAARPGGRERARLANVEDQARSNRGLLAKIFGAPLPAESKEKP |